BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10620 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 27 3.7 SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizo... 25 8.6 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 26.6 bits (56), Expect = 3.7 Identities = 8/42 (19%), Positives = 25/42 (59%) Frame = -1 Query: 538 VLFSSMLHQYLTYRGISI*FYICKKILYYNNILCSMIETTYA 413 +L + +LH + ++ +S+ ++C ++Y+ C + ++Y+ Sbjct: 194 ILLNEVLHPFYLFQAVSVLIWLCDSFVFYS--CCIVFISSYS 233 >SPAC1142.03c |swi2|SPAC17G6.20c|Swi5 complex subunit Swi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.4 bits (53), Expect = 8.6 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +2 Query: 266 YCNSIFLVENSFSNQVSIIKYYTIKTV*SDIYTLNTLLSNE 388 Y NS+ + N+ SN +IIK T K NT+LSNE Sbjct: 481 YKNSVLSIGNNHSNHSNIIKPNTYK---------NTILSNE 512 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,118,607 Number of Sequences: 5004 Number of extensions: 36180 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -