BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10618X (469 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.6 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 5.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -1 Query: 460 PIQQLKYQPPMSHGSCNSALGILLQQFPLVVDLLTPSCGSPN 335 P+ + P + + +SA G + + P TP C S N Sbjct: 858 PMTNDDFNPNIEEEASDSAQGRAILKIPSYKPASTPGCSSKN 899 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 211 GTGISSNDDSTIKLACHD 158 G GI NDD T + C++ Sbjct: 206 GRGIYHNDDKTFLVWCNE 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,553 Number of Sequences: 438 Number of extensions: 3461 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -