BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10610 (435 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0433 - 3402250-3402536,3402644-3403030,3403523-3403957,340... 28 2.9 11_06_0312 - 22286883-22287007,22288214-22288244 27 6.6 >12_01_0433 - 3402250-3402536,3402644-3403030,3403523-3403957, 3404071-3404562,3404718-3404821,3404913-3404994, 3405085-3405441,3405532-3406089,3406376-3406479, 3406575-3406650,3406764-3406898,3407192-3407494, 3407581-3408345,3409459-3412591,3412763-3412882 Length = 2445 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 323 CFAAVRERV-VISTDILSFIENSLIKPSYVSM 415 C + R R+ IST +LSF +S +KPS+++M Sbjct: 2353 CQTSGRRRIDEISTKLLSFKISSTVKPSHIAM 2384 >11_06_0312 - 22286883-22287007,22288214-22288244 Length = 51 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 361 GTNDHPFSYCCEAIVRFGSKNPQTS 287 G + FS CC +IVRFG NP+ S Sbjct: 11 GLENDAFSGCCISIVRFG--NPEKS 33 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,069,634 Number of Sequences: 37544 Number of extensions: 209914 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -