BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10608 (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) 82 5e-16 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 29 4.7 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) 28 6.2 SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) Length = 81 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = +3 Query: 363 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKK 509 S+SLIKQIPR+LGPGLNKAGKFP ++H E+M QKI++V+ TIKFQMKK Sbjct: 28 SDSLIKQIPRILGPGLNKAGKFPTPINHNENMVQKIEDVRSTIKFQMKK 76 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 32.3 bits (70), Expect = 0.38 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +2 Query: 521 SVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKST 652 ++ VGH E+ N+ +++ L ++ + W N++SL++K++ Sbjct: 322 AMKVGHTGQEKKEVISNIVEAVSGLAKIIPRGWNNIQSLNIKTS 365 >SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 605 AVTQGS*WKDAHSEQAHQESCPH 537 AV+ WK H+ Q QESCPH Sbjct: 103 AVSNPCFWKWIHAHQTAQESCPH 125 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 127 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHCDEL 258 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC +L Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHCIKL 379 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 518 LSVAVGHVDMTPDELAQNVHLSINFLVSLLKKH 616 +S AV + TPD ++ V +N L SL KKH Sbjct: 654 VSSAVSEMSDTPDNVSNQVEKVVNELKSLKKKH 686 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 127 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHCDEL 258 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC +L Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHCIKL 379 >SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) Length = 1286 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 582 PSTSLCHCSRNTGRMSD 632 PS CHC N GRM D Sbjct: 526 PSDPTCHCPSNNGRMKD 542 >SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 81 KNGIHALVERVTRHFRRHFVCQRTTYH 1 K G+H ++ +VT + RRH++ + T H Sbjct: 284 KKGVHMILGQVTGNARRHYIPKFTANH 310 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 380 ADSPFVGSRFEQSW*IPWSSLPPGVHDAED 469 +DSP+ G+ + W I S+ P VHD D Sbjct: 725 SDSPYSGNSSGEDWDIYSSAQPTAVHDLPD 754 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,457,858 Number of Sequences: 59808 Number of extensions: 465330 Number of successful extensions: 1133 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -