BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10608 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.0 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 25 3.0 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 7 GGSLTNKMSSKVSRDTLYECVNAVLQSSKDKKRNFLET 120 GG++ K+ +K SRD + +N + + + + F ET Sbjct: 1389 GGAVPFKLLTKKSRDQALKAINFIEREQQQEMEIFEET 1426 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 580 FHQLPCVTAQETLAECPIIAYEINDGTT 663 FH +P + TLA+C + Y + TT Sbjct: 10 FHIVPVSGPRRTLADCSLGGYRVPKDTT 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,869 Number of Sequences: 2352 Number of extensions: 14558 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -