BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10606 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 3.2 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 4.2 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 4.2 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 7.4 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = -1 Query: 579 QAERLVHGAAHGQIVHRHVTQGAIRSIMNKPLN 481 + E L+H + Q + H ++ ++ I+N+P++ Sbjct: 314 EQEELIHRLVYFQNEYEHPSEEDVKRIINQPMD 346 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = +1 Query: 619 CPAGW---NPDTNADTIKPNP 672 CP G+ N + N D KPNP Sbjct: 210 CPKGFQGQNCELNVDDCKPNP 230 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 23 KNVVHCEATKSKCTVAG 73 KN V+C K KCT G Sbjct: 44 KNYVNCLLEKGKCTPDG 60 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 210 TGKYVVLFFYPLDFTL 257 T K+ F+P+DFTL Sbjct: 352 TSKFSAAGFFPVDFTL 367 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 23 KNVVHCEATKSKCTVAG 73 KN V+C K +CT G Sbjct: 39 KNYVNCLLDKGRCTPEG 55 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,120 Number of Sequences: 336 Number of extensions: 3498 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -