BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10606 (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) 126 2e-29 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 85 5e-17 SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45252| Best HMM Match : DIT1_PvcA (HMM E-Value=6.5e-07) 31 0.90 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) 29 3.6 SB_55365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_43985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_32482| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_22242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_50986| Best HMM Match : UDPG_MGDP_dh (HMM E-Value=0) 28 8.4 SB_23043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_8943| Best HMM Match : LTXXQ (HMM E-Value=0.45) 28 8.4 >SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) Length = 265 Score = 126 bits (303), Expect = 2e-29 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 1/101 (0%) Frame = +2 Query: 206 FHGKIRSSVLLSIGFHIVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTPRK 385 + GK + F VCPTE+IAFSD+ +F I+C+VI S DSE+SHLAW N PRK Sbjct: 79 YKGKYVVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNVPRK 138 Query: 386 DGGLGKMEIPLLADYKKQISKDYDVLLDD-GFALRGLFIID 505 GG+G + IP+L+D KQISKDY VLL+D G ALRGLFIID Sbjct: 139 KGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIID 179 Score = 84.2 bits (199), Expect = 9e-17 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +1 Query: 511 GTLRHMSVNDLPVGRSVDETLRLVKAFQFADKHGEVCPAGWNPDTNADT 657 G LR +++NDLPVGRSVDETLRL++AFQF DKHGEVCPAGW P ADT Sbjct: 182 GILRQITINDLPVGRSVDETLRLIQAFQFTDKHGEVCPAGWRP--GADT 228 Score = 76.2 bits (179), Expect = 2e-14 Identities = 41/74 (55%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Frame = +3 Query: 36 IVKQLSRSVLSPAFKVAKRINFSTTSTTRAPKVQKPAPDFSATAV-VNGEFNQLKLSDFT 212 +V Q R+ +PAF +AKR+ + + +QKPAP FS TAV +GEF LKLSD+ Sbjct: 22 LVLQQPRNA-APAFHLAKRMMSFSRADMSKTAIQKPAPAFSGTAVNKHGEFIDLKLSDYK 80 Query: 213 GKYVVLFFYPLDFT 254 GKYVVLFFYPLDFT Sbjct: 81 GKYVVLFFYPLDFT 94 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 85.0 bits (201), Expect = 5e-17 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 511 GTLRHMSVNDLPVGRSVDETLRLVKAFQFADKHGEVCPAGWNPDTNADT 657 G LR +++NDLPVGRSVDETLRL++AFQF DKHGEVCPAGW P + T Sbjct: 51 GILRQITINDLPVGRSVDETLRLIQAFQFTDKHGEVCPAGWRPGADTGT 99 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +2 Query: 371 NTPRKDGGLGKMEIPLLADYKKQISKDYDVLLDD-GFALRGLFIID 505 N PRK GG+G + IP+L+D KQISKDY VLL+D G ALRGLFIID Sbjct: 3 NVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIID 48 >SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 81.0 bits (191), Expect = 9e-16 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = +1 Query: 547 VGRSVDETLRLVKAFQFADKHGEVCPAGWNPDTNADTIKPNPKDSKEYFQK 699 VGRSVDETLRLV+AFQ+ DKHGEVCPAGW P DTI P+P K+YF+K Sbjct: 1 VGRSVDETLRLVQAFQYTDKHGEVCPAGWKP--GKDTIIPDPTQKKKYFEK 49 >SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 70.5 bits (165), Expect = 1e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 129 KVQKPAPDFSATAVVNGEFNQLKLSDFTGKYVVLFFYPLDFT 254 ++ KPAP + TAVVNGEF +LKLSDF GKY+V FFYPLDFT Sbjct: 55 QISKPAPFWEGTAVVNGEFKELKLSDFEGKYLVFFFYPLDFT 96 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/54 (48%), Positives = 35/54 (64%) Frame = +2 Query: 206 FHGKIRSSVLLSIGFHIVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAW 367 F GK + F VCPTE+IAFSD+ ++F I+ +V+G S DS F+HLAW Sbjct: 81 FEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAW 134 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 511 GTLRHMSVNDLPVGRSVDETLRLVKAFQFADKH 609 G LR +++NDLPVGRSVDETLRLV+AFQ+ DKH Sbjct: 143 GVLRQITMNDLPVGRSVDETLRLVQAFQYTDKH 175 >SB_45252| Best HMM Match : DIT1_PvcA (HMM E-Value=6.5e-07) Length = 211 Score = 31.1 bits (67), Expect = 0.90 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 45 QLSRSVLSPAFKVAKRIN-FSTTSTTRAPKVQKPAPDFSATAVVNGEFNQLKLSDFTGK 218 QL++SVLS + + I TT PK +P + ATA++ + + L F GK Sbjct: 17 QLAQSVLSKVMQFRRMIEECQDNCTTECPKCHRPHENKVATAIMQNKKIRFVLPGFPGK 75 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 516 PASHVGERSARGPLRGRDAPPGQGLPVRRQARRGVPG 626 P+ +R P RGRDAPPG+G + RG PG Sbjct: 788 PSRGFQDRDRGPPGRGRDAPPGRGQGYTNRG-RGQPG 823 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +3 Query: 525 HVGERSARGPLRGRDAPPGQGLPVRRQARRGVPGRLEPGHQRRHHQAEPQG 677 H ER P RGRD P + + R + G P R P Q R +P+G Sbjct: 599 HRDERPEEFPRRGRDEP--EFVRPRGRDDGGRPSREPPRDQHRRPYDDPEG 647 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 552 PLRGRDAPPGQGLPVRRQARRGVPGRLEPGHQRR 653 P+RGR AP G+G P R RG P PG RR Sbjct: 83 PMRGRGAPYGRGGPPSRGPPRGPP---LPGPPRR 113 >SB_58829| Best HMM Match : HC2 (HMM E-Value=5.8) Length = 959 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = -2 Query: 620 HTSPCLSANWKALTRRSVSST---ERPTGRSFTDM*RRVPYGRL*TNLLMQTHHRVIHHN 450 H + C +A K L +T + + T + ++ + + T LL Q HH H Sbjct: 755 HHNQCHTALLKQLHHNQCHTTLLKQVHHNQCHTTLLKQAHHNQCHTTLLKQAHHNKCHTT 814 Query: 449 LLKSVFCNQ 423 LLK V NQ Sbjct: 815 LLKQVHHNQ 823 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + R+ + + T LL Q HH H LLK + NQ Sbjct: 566 TTLLRKADHNQCHTTLLKQAHHNQCHTALLKQLHHNQ 602 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + +++ + + T LL Q HH H LLK V NQ Sbjct: 592 TALLKQLHHNQCQTTLLKQVHHNQCHTTLLKQVHHNQ 628 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + ++V + + T LL Q HH H LLK NQ Sbjct: 826 TTLLKQVHHNQCHTTLLKQVHHHQCHTTLLKQAHHNQ 862 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + ++V + + T LL Q HH H LLK + NQ Sbjct: 670 TTLLKQVHHNQCHTTLLKQAHHNQCHTALLKQLHHNQ 706 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + ++V + + T LL Q HH H LLK V +Q Sbjct: 813 TTLLKQVHHNQCQTTLLKQVHHNQCHTTLLKQVHHHQ 849 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + ++V + + T LL Q HH H LLK + NQ Sbjct: 839 TTLLKQVHHHQCHTTLLKQAHHNQCHTTLLKQLHHNQ 875 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + R + + T LL Q HH H LLK + NQ Sbjct: 631 TTLLREADHNQCHTTLLKQAHHNQCHTALLKQLHHNQ 667 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 533 TDM*RRVPYGRL*TNLLMQTHHRVIHHNLLKSVFCNQ 423 T + R + + T LL Q HH H LLK + NQ Sbjct: 735 TTLLREADHNQCHTTLLKQAHHNQCHTALLKQLHHNQ 771 >SB_55365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +3 Query: 513 HPASHVGERSARGPLRGRDAPPGQGLPVRRQARRGVPGRLEPGH 644 HP S R PL GR APP P+R R V R GH Sbjct: 30 HPTSISHVRFQAKPLHGRQAPP----PIRIAVRARVKERKRCGH 69 >SB_43985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 461 IHHNLLKSVFCNQQAEEFPFFPIHRPS*EC*SMRGD 354 + + V CN+ + PF H S C S+RGD Sbjct: 74 VDSKICSKVLCNRLVDILPFLDFHLSSSICLSVRGD 109 >SB_32482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/62 (32%), Positives = 28/62 (45%) Frame = +3 Query: 204 DFTGKYVVLFFYPLDFTLYVRQSS*RSVIKLKTLLESIVR*LECPQTLSSVTSHGSTLLG 383 +F GK V L P ++ RQ LL+ + EC + S +S G+T LG Sbjct: 444 EFPGKVVTLDMVPEHIGIFQRQRQPSVEGMYGVLLDHFLL-SECHYLILSSSSFGTTALG 502 Query: 384 RT 389 RT Sbjct: 503 RT 504 >SB_22242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -3 Query: 367 PCEVTELRVCGHSNHLTIDSSKVFSFITERYELCRTYNVKSNG*KNRTTYFPVKSESL-S 191 PC + E VC H H +++S + F+ C N + +G + + YFPV + S+ + Sbjct: 566 PCYICESCVCSHCLH-KVETSSSYVFMENE---CT--NKRDSGFCDSSPYFPVCASSMPN 619 Query: 190 *LNSPLTT 167 +SP T Sbjct: 620 SFSSPALT 627 >SB_50986| Best HMM Match : UDPG_MGDP_dh (HMM E-Value=0) Length = 354 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +2 Query: 236 LSIGFHIVCPTELIAFSDKAKDFAGIDCQVIGVSTDSEFSHLAWINTP 379 +SI F +V E + D DF D VIG +D F + + P Sbjct: 56 MSIKFDVVSNPEFLKEGDAINDFMKPDRVVIGAESDYAFDKMRQLYAP 103 >SB_23043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 345 LSSVTSHGSTLLGRTVDWEKWKFL 416 L SVT H ++LL T+ WE+++ L Sbjct: 294 LLSVTYHANSLLVATISWERFEIL 317 >SB_8943| Best HMM Match : LTXXQ (HMM E-Value=0.45) Length = 415 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 345 LSSVTSHGSTLLGRTVDWEKWKFL 416 L SVT H ++LL T+ WE+++ L Sbjct: 294 LLSVTYHANSLLVATISWERFEIL 317 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,845,925 Number of Sequences: 59808 Number of extensions: 457516 Number of successful extensions: 1591 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1585 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -