BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10603 (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 25 1.5 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 2.0 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 23 4.5 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 4.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 22 7.9 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.6 bits (51), Expect = 1.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 97 KRLHGVGFKKRAPRAIKEIR 156 +RLH GF R PR +++++ Sbjct: 96 RRLHAAGFCARRPRKVRKLQ 115 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.2 bits (50), Expect = 2.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 97 KRLHGVGFKKRAPRAIKEI 153 +RLH GF R PR ++++ Sbjct: 24 RRLHAAGFCARRPRKVRKL 42 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 23.0 bits (47), Expect = 4.5 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 104 SRLCKLTVYSRVTIRLWLICLFFHLWV*PLL 12 +R+ + + + +R + FFH+W+ PLL Sbjct: 96 ARVDEYLSWQHLNLRADVSLYFFHVWLNPLL 126 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.0 bits (47), Expect = 4.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 266 PHTDRKGTFLTPLDQRNLFKRVST 195 P +D +GT LT +QR F + T Sbjct: 509 PKSDERGTALTFREQRRYFIEMDT 532 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.2 bits (45), Expect = 7.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 384 HGWHQHFLSASP 349 HG+H++FL SP Sbjct: 2068 HGFHKYFLHLSP 2079 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 405,623 Number of Sequences: 2352 Number of extensions: 7002 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -