Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10593X
         (420 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   6.0  

>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 22.6 bits (46), Expect = 6.0
 Identities = 18/70 (25%), Positives = 30/70 (42%)
 Frame = -3

Query: 280 YWVQSCGPNSRRVNPLPARTLVWYRTVGHRTIGRNGPAAGRGATALAFFILFCFLRYRRA 101
           +  ++C   SRR +   A+T  W R V H     +      GA+ L F    C  +Y+  
Sbjct: 227 FCTEACFSQSRRASFKRAKTCDWCRHVRHAV---SYVDFQDGASQLQFCSDKCLNQYKMQ 283

Query: 100 GWLNQVLTNL 71
            + N+   +L
Sbjct: 284 IFCNETQAHL 293


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 455,501
Number of Sequences: 2352
Number of extensions: 8424
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 34632603
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)