BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10585 (780 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 26 0.39 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 3.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.3 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 6.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 6.3 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.3 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 25.8 bits (54), Expect = 0.39 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -2 Query: 176 LSLIFKIDSALLFLTFPVSLLMIFQVIL 93 L +F + S L+F FP+++L+I +++ Sbjct: 233 LPCVFFLGSILIFFIFPLAILIIVYILI 260 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 581 LPTLSKIFEKIILEQLLNHFYSNNLLHNKQYGFTRGRSTIDAGVDLIKNIF 733 + +LS++ L+ F+++ L YG G T+ G + IKNI+ Sbjct: 76 ISSLSEVKMDFTLDFYFRQFWTDPRL---AYGKRPGVETLSVGSEFIKNIW 123 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 261 KLRFCSRSWDISKVALKSTGHFLM 190 KLRF +R I K ++ G FL+ Sbjct: 195 KLRFTTRKETIYKQSIVDMGEFLL 218 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 582 STEMGLKLVGSKVLPDLNRGIILL 511 +T + LKL+ S +LPD+ + +L Sbjct: 321 TTNLVLKLLTSPLLPDIKEQVEIL 344 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 130 NVRNSNAESILKIND 174 N++N N SIL+ ND Sbjct: 574 NIKNFNIPSILQFND 588 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 261 KLRFCSRSWDISKVALKSTGHFLM 190 KLRF +R I K ++ G FL+ Sbjct: 195 KLRFTTRKETIYKQSIVDMGEFLL 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,728 Number of Sequences: 336 Number of extensions: 3732 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -