BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10585 (780 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0659 + 19647037-19647464,19647569-19647659,19648998-196490... 31 0.78 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 30 2.4 06_02_0297 - 13891954-13892556,13893019-13893855,13894179-138943... 29 4.1 01_05_0762 + 24990915-24990970,24991076-24991592,24991676-249917... 29 5.5 04_04_1504 + 34035109-34035198,34035586-34036002,34038385-34039017 28 7.2 >10_08_0659 + 19647037-19647464,19647569-19647659,19648998-19649039, 19649179-19649237,19649559-19649634,19649735-19649866, 19650251-19650358,19651040-19651094,19651187-19651437 Length = 413 Score = 31.5 bits (68), Expect = 0.78 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 5/83 (6%) Frame = +2 Query: 521 IPLFKSGSTF---DPTNFRPISVLPTLSKIFEKIILEQLLNHFYSNNLLHNKQYGFTRGR 691 +P K G + D T P+ +LP L+ + + +E L N + K F+RG Sbjct: 240 VPSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGMEGNPMARKMKNFSRGM 299 Query: 692 S--TIDAGVDLIKNIFQAWEESH 754 + T+ + K IF W S+ Sbjct: 300 AVLTVPFTMSFAKGIFCYWITSN 322 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +1 Query: 46 KSLHLGKLIKNAPDKIKMTWNIINRETGNVRNSNAESILKINDKIITSHQEVAS 207 K LH K ++ AP++ +M W+ I + + ES+ N + T H+EV S Sbjct: 449 KPLHWDK-VRAAPNR-RMVWDRIRSSSFELDEKMIESLFGYNARCSTKHEEVQS 500 >06_02_0297 - 13891954-13892556,13893019-13893855,13894179-13894394, 13895455-13895874,13896198-13896506 Length = 794 Score = 29.1 bits (62), Expect = 4.1 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 512 SKIIPLFKSGSTFDPTN-FRPISVLPTLSKIFEKIILEQLLNHFYSNNLLHNKQYGFTRG 688 S I L ++ + N FRPIS++ KI K++ +L L+ + YGF +G Sbjct: 370 SSFITLVPKKTSLETVNDFRPISLMGISLKIVTKLLAGRLQGVIL--KLVSDNHYGFIKG 427 Query: 689 RSTID 703 ++ D Sbjct: 428 KTIQD 432 >01_05_0762 + 24990915-24990970,24991076-24991592,24991676-24991753, 24993678-24993743,24994819-24994943,24995414-24995612, 24995909-24996137,24996259-24996425,24996526-24996735, 24997245-24997355,24997436-24997612,24997826-24998284, 24998676-24998966 Length = 894 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 240 FYYKILISSPTVAESLLQDHVDECSVNFKFTNIAIKD-IIDNFKTINI 380 FYY++L P VAE ++ SV + IKD I D F ++++ Sbjct: 594 FYYRLLQYDPAVAERVVNPPKQAVSVFADTQSSEIKDRIFDEFNSLSV 641 >04_04_1504 + 34035109-34035198,34035586-34036002,34038385-34039017 Length = 379 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 166 INDKIITSHQEVASAFERYFADIPASTTKS*FHLLP 273 + DK S + F YF+D+P++ + FHLLP Sbjct: 85 MTDKSFGSKDDDGLEFCFYFSDLPSNDFNTLFHLLP 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,787,402 Number of Sequences: 37544 Number of extensions: 327309 Number of successful extensions: 714 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -