BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10584 (468 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 6.6 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.6 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = +3 Query: 234 YNHLMPTVIQLTSALKNSAQKT*KTLQNVRSCV 332 YN+L +I + ++N ++ Q++ CV Sbjct: 3 YNNLTIVIILIMCGVQNLRARSVNIFQDIADCV 35 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 88 ITTKVPPTSRTGMLSSLVSTGTP 156 IT + PP T VS GTP Sbjct: 608 ITIQEPPQWHTRSTEKRVSAGTP 630 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,830 Number of Sequences: 438 Number of extensions: 2848 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -