BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10572 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0649 + 19589807-19591024 29 3.3 08_02_0856 - 21928499-21929626,21929728-21929788,21929950-21930899 28 5.8 10_08_0645 - 19562886-19564484 28 7.7 >10_08_0649 + 19589807-19591024 Length = 405 Score = 29.1 bits (62), Expect = 3.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 4 CSGFGASTLNWTPSPW 51 C+G+GA+ +W P PW Sbjct: 31 CAGWGAAAASWRPRPW 46 >08_02_0856 - 21928499-21929626,21929728-21929788,21929950-21930899 Length = 712 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 230 CRIMPKAKRIAQEECQEMNKPPGDPFWASRTVAILGIIISKLCR 361 C I+ + A+EEC ++ PGD W I S L R Sbjct: 110 CTILVASSTEAEEECYLLHCHPGDEMWTKSVSPYDDISFSSLMR 153 >10_08_0645 - 19562886-19564484 Length = 532 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 328 GDGTTSPKWVSRRFVH 281 GDG SPKW S F H Sbjct: 186 GDGAPSPKWTSAPFTH 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,813,723 Number of Sequences: 37544 Number of extensions: 261321 Number of successful extensions: 528 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -