BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10572 (666 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38080.1 68418.m04588 hypothetical protein 29 2.1 At4g12750.1 68417.m02002 expressed protein 29 2.1 >At5g38080.1 68418.m04588 hypothetical protein Length = 157 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -3 Query: 274 AFFLGDALCLWHYSTFSLFCPWVHLLHYLHPHSV---ALPCSFSFILIFL 134 A+F+G +C TF FC +VHLL+ + PH LPC F+ + + Sbjct: 69 AYFVG-RIC----HTFG-FCIFVHLLYSVSPHLALYFGLPCLLGFVAVMI 112 >At4g12750.1 68417.m02002 expressed protein Length = 1108 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 206 NPRAKKRKCRIMPKAKRIAQEECQEMNKP-PGDPF 307 NP +K KCR K K +E C E+++ PG+P+ Sbjct: 592 NPALRKVKCRKRRKHKSKMREVCSEIDESHPGEPW 626 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,631,725 Number of Sequences: 28952 Number of extensions: 201217 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -