BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10570 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 2e-41 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_56| Best HMM Match : Actin (HMM E-Value=0) 165 3e-41 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 165 4e-41 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 143 1e-34 SB_54| Best HMM Match : Actin (HMM E-Value=0) 79 3e-15 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 55 5e-08 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 54 9e-08 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 36 0.024 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) 29 3.7 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 29 4.9 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 4.9 SB_53874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) 28 8.5 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 165 bits (402), Expect = 2e-41 Identities = 76/83 (91%), Positives = 81/83 (97%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 267 LYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 326 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGP+IVHRKCF Sbjct: 327 QQMWISKQEYDESGPAIVHRKCF 349 Score = 133 bits (321), Expect = 2e-31 Identities = 61/65 (93%), Positives = 63/65 (96%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 ASSSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 205 ASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIR 264 Query: 524 KDLYA 510 KDLYA Sbjct: 265 KDLYA 269 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 256 LYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 315 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGP+IVHRKCF Sbjct: 316 QQMWISKQEYDESGPAIVHRKCF 338 Score = 136 bits (328), Expect = 2e-32 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 194 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 253 Query: 524 KDLYA 510 KDLYA Sbjct: 254 KDLYA 258 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 Score = 136 bits (328), Expect = 2e-32 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 524 KDLYA 510 KDLYA Sbjct: 292 KDLYA 296 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 165 bits (401), Expect = 3e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 Score = 136 bits (328), Expect = 2e-32 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 231 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 524 KDLYA 510 KDLYA Sbjct: 291 KDLYA 295 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 165 bits (400), Expect = 4e-41 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 294 LYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 353 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 354 QQMWISKQEYDESGPSIVHRKCF 376 Score = 136 bits (328), Expect = 2e-32 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 232 ASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 291 Query: 524 KDLYA 510 KDLYA Sbjct: 292 KDLYA 296 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 163 bits (396), Expect = 1e-40 Identities = 76/83 (91%), Positives = 80/83 (96%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L +TVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTF Sbjct: 293 LYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTF 352 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWISKQEYDESGPSIVHRKCF Sbjct: 353 QQMWISKQEYDESGPSIVHRKCF 375 Score = 134 bits (325), Expect = 5e-32 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 A+SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIR Sbjct: 231 AASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIR 290 Query: 524 KDLYA 510 KDLYA Sbjct: 291 KDLYA 295 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 143 bits (347), Expect = 1e-34 Identities = 65/83 (78%), Positives = 74/83 (89%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 340 L + VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTF Sbjct: 67 LYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTF 126 Query: 339 QQMWISKQEYDESGPSIVHRKCF 271 QQMWI+K+EY E GP IVHRKCF Sbjct: 127 QQMWIAKEEYHEYGPPIVHRKCF 149 Score = 118 bits (285), Expect = 4e-27 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -2 Query: 704 ASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR 525 A+S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 524 KDLYA 510 KDLY+ Sbjct: 65 KDLYS 69 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 79.0 bits (186), Expect = 3e-15 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = -2 Query: 701 SSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRK 522 +S E Y LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D+R Sbjct: 2277 TSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRA 2336 Query: 521 DLY 513 +L+ Sbjct: 2337 ELF 2339 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 65.3 bits (152), Expect = 5e-11 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = -2 Query: 689 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLY 513 L + Y LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFY 298 Score = 44.8 bits (101), Expect = 7e-05 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 2/104 (1%) Frame = -1 Query: 603 LVLGYGSLRHPRDHI*LHHEVRRGHP*GLVRHTVLSGGTTMYPGIADRMQKEITA-LAPS 427 +VL GS +P L E+++ L VL G T+ Q +TA Sbjct: 301 IVLSGGSTMYPGLPSRLEREIKQ-----LYLERVLKGDTSKLSSGMGMEQIPLTADYLLQ 355 Query: 426 TMKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 298 KI+I PP RK+ V++GG++LA + W++++EY+E G Sbjct: 356 KFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 55.2 bits (127), Expect = 5e-08 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 16/103 (15%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPERK 388 L ++ VLSGG+TM+ R+Q++I + P ++ ++I+ ++ Sbjct: 242 LYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQR 301 Query: 387 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*THR 259 Y+VW GGS+LAS F + +K +YDE GPSI F HR Sbjct: 302 YAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF-LHR 343 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -2 Query: 653 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLY 513 + + ERF PE F P F + + E N I C +D+R+ LY Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLY 243 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 54.4 bits (125), Expect = 9e-08 Identities = 23/61 (37%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = -1 Query: 522 GLVRHTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILAS 352 GL +++GG T+ G +R+ +E+ + P +M++K+I+ E++++ WIGGSILAS Sbjct: 170 GLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILAS 229 Query: 351 L 349 L Sbjct: 230 L 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 9/81 (11%) Frame = -1 Query: 519 LVRHTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIAPP-ERKYSVWIGG 367 L + VL GGT M PG R+ +EI L S +K+ PP + W+GG Sbjct: 77 LAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGG 136 Query: 366 SILASLSTFQQMWISKQEYDE 304 +I SL +++ Y + Sbjct: 137 AIFGSLEVLADRSTTRERYQQ 157 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = -2 Query: 701 SSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 594 ++ L K Y LPDGQ+I+IG E E LF+P L Sbjct: 863 TNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 623 PEALFQPSFLGMEACGIHET 564 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_48528| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 329 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 693 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 607 LPR ++R HY++ +PLPRG P Sbjct: 132 LPRGGSPLTKRRESHYQEEGVPLPRGGSP 160 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 693 LPREVLRTSRRSGHHYRKRKIPLPRGSLP 607 LPR ++R HY++ +PLPRG P Sbjct: 154 LPRGGSPLTKRRESHYQEEGVPLPRGGGP 182 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 687 REVLRTSRRSGHHYRKRKIPLPR--GSLPTLVLGYGSLRHPR 568 R++LR R HHYR+ + R G++P + Y + R PR Sbjct: 521 RDLLRALRNKKHHYRELPDEVKRSLGTIPDEYVRYFTSRFPR 562 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 655 SSLSETKDSVAQRLSSNPRSWVWK 584 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_53874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 703 HPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAASTRPHI 557 HP SR +N P V S + V R+ SN V+ S +PH+ Sbjct: 113 HPHVYSRVKSNHPHVYSRVKSNHPHVYSRVKSN-HPHVYSRVKSNQPHV 160 >SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) Length = 676 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 703 HPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAASTRPHI 557 HP SR +N P V S + V R+ SN V+ S +PH+ Sbjct: 615 HPHVYSRVKSNHPHVYSRVKSNHPHVYSRVKSN-HPHVYSRVKSNQPHV 662 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,162,365 Number of Sequences: 59808 Number of extensions: 535870 Number of successful extensions: 1679 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1659 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -