BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10553 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 173 1e-43 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 171 6e-43 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 169 1e-42 SB_56| Best HMM Match : Actin (HMM E-Value=0) 169 1e-42 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 169 2e-42 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 168 4e-42 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 150 8e-37 SB_54| Best HMM Match : Actin (HMM E-Value=0) 107 1e-23 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 59 4e-09 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 58 8e-09 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 52 4e-07 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 41 0.001 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 4.4 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.4 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 7.6 SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) 28 7.6 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 28 7.6 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 173 bits (421), Expect = 1e-43 Identities = 79/84 (94%), Positives = 83/84 (98%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTVMSGGTTMYPG+ADRMQKEI+ALAPST+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 266 DLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLST 325 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 326 FQQMWISKQEYDESGPAIVHRKCF 349 Score = 165 bits (402), Expect = 2e-41 Identities = 77/84 (91%), Positives = 80/84 (95%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKLCYVALDFEQEM TAA+S+S+EKSYELPDGQVITIGNERFRCPEAL QPSFL Sbjct: 182 IVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFL 241 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 242 GMESSGIHETTYNSIMKCDVDIRK 265 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 171 bits (415), Expect = 6e-43 Identities = 78/84 (92%), Positives = 82/84 (97%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTV+SGGTTMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 255 DLYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLST 314 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 315 FQQMWISKQEYDESGPAIVHRKCF 338 Score = 168 bits (409), Expect = 3e-42 Identities = 78/84 (92%), Positives = 81/84 (96%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFL Sbjct: 171 IVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL 230 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 231 GMESAGIHETTYNSIMKCDVDIRK 254 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 169 bits (412), Expect = 1e-42 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 293 DLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLST 352 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 353 FQQMWISKQEYDESGPSIVHRKCF 376 Score = 168 bits (409), Expect = 3e-42 Identities = 78/84 (92%), Positives = 81/84 (96%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFL Sbjct: 209 IVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL 268 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 269 GMESAGIHETTYNSIMKCDVDIRK 292 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 169 bits (412), Expect = 1e-42 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTV+SGG+TMYPGIADRMQKEIT+LAP T+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 292 DLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLST 351 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 352 FQQMWISKQEYDESGPSIVHRKCF 375 Score = 168 bits (409), Expect = 3e-42 Identities = 78/84 (92%), Positives = 81/84 (96%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFL Sbjct: 208 IVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL 267 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 268 GMESAGIHETTYNSIMKCDVDIRK 291 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 169 bits (411), Expect = 2e-42 Identities = 77/84 (91%), Positives = 82/84 (97%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTV+SGG+TMYPGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 293 DLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLST 352 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 353 FQQMWISKQEYDESGPSIVHRKCF 376 Score = 169 bits (410), Expect = 2e-42 Identities = 78/84 (92%), Positives = 81/84 (96%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKLCYVALDFEQEM TAA+S+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFL Sbjct: 209 IVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL 268 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 269 GMESAGIHETTYNSIMKCDVDIRK 292 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 168 bits (408), Expect = 4e-42 Identities = 79/84 (94%), Positives = 81/84 (96%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IVRDIKEKL YVALDFEQEMATAAAS+SLEKSYELPDGQVITIGNERFRCPEA+FQPSFL Sbjct: 208 IVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL 267 Query: 183 GMESCGIHETVYNSIMKCDVDIRK 254 GMES GIHET YNSIMKCDVDIRK Sbjct: 268 GMESAGIHETTYNSIMKCDVDIRK 291 Score = 167 bits (407), Expect = 5e-42 Identities = 76/84 (90%), Positives = 82/84 (97%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLYANTV+SGG+TM+PGIADRMQKEI+ALAP T+KIKIIAPPERKYSVWIGGSILASLST Sbjct: 292 DLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLST 351 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWISK+EYDESGP IVHRKCF Sbjct: 352 FQQMWISKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 150 bits (364), Expect = 8e-37 Identities = 67/84 (79%), Positives = 77/84 (91%) Frame = +2 Query: 254 DLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLST 433 DLY+N V+SGG+TM+PGIADRMQKEI LA +++K+K+IAPPERKYSVWIGGSILASLST Sbjct: 66 DLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLST 125 Query: 434 FQQMWISKEEYDESGPGIVHRKCF 505 FQQMWI+KEEY E GP IVHRKCF Sbjct: 126 FQQMWIAKEEYHEYGPPIVHRKCF 149 Score = 110 bits (265), Expect = 8e-25 Identities = 49/61 (80%), Positives = 55/61 (90%) Frame = +3 Query: 72 AASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIR 251 A S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGME+ GIHE +YN IMKCDVDIR Sbjct: 5 ANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIR 64 Query: 252 K 254 K Sbjct: 65 K 65 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 107 bits (256), Expect = 1e-23 Identities = 47/83 (56%), Positives = 60/83 (72%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 I+RD+KE LCY A+D+E+E+ A S E Y LPDGQ I IG+ERFR E LFQPS L Sbjct: 2253 IIRDLKETLCYCAMDYERELKEAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLL 2312 Query: 183 GMESCGIHETVYNSIMKCDVDIR 251 G + GIHE+++ SI KCD+D+R Sbjct: 2313 GRDIDGIHESIFKSIKKCDIDLR 2335 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 88.6 bits (210), Expect = 4e-18 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = +3 Query: 6 VRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG 185 VR +KEKLCYV + EQE A +T L + Y LPDG+V+ + ERF PEALFQP + Sbjct: 213 VRMMKEKLCYVGYNIEQEQKLALETTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHLIN 272 Query: 186 MESCGIHETVYNSIMKCDVDIR 251 +E G+ E ++N+I D+D R Sbjct: 273 VEGVGVAELLFNTIQAADIDTR 294 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +2 Query: 257 LYANTVMSGGTTMYPGIADRMQKEITA-LAPSTIKIKIIAPPERKYSVWIGGSILAS-LS 430 LY V+ G T+ Q +TA KI+I PP RK+ V++GG++LA + Sbjct: 324 LYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLADIMK 383 Query: 431 TFQQMWISKEEYDESG 478 W++++EY+E G Sbjct: 384 DKDSFWMTRKEYEEKG 399 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 58.8 bits (136), Expect = 4e-09 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 16/106 (15%) Frame = +2 Query: 257 LYANTVMSGGTTMYPGIADRMQKEITA----------------LAPSTIKIKIIAPPERK 388 LY N V+SGG+TM+ R+Q++I + P I+ ++I+ ++ Sbjct: 242 LYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQR 301 Query: 389 YSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF*QRARVT 526 Y+VW GGS+LAS F + +K +YDE GP I F R ++ Sbjct: 302 YAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPFLHRDEIS 347 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 123 ITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRK 254 + + ERF PE F P F + + + E V N I C +D+R+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRR 240 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 57.6 bits (133), Expect = 8e-09 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 182 IV DIKEK+CY++ D +E+ + L K Y LPDGQ+I+IG E E LF+P L Sbjct: 839 IVNDIKEKICYLSKDHLKEVHNYKTNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 52.0 bits (119), Expect = 4e-07 Identities = 21/60 (35%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = +2 Query: 257 LYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIA---PPERKYSVWIGGSILASL 427 L+ + +++GG T+ G +R+ +E+ + P ++++K+I+ E++++ WIGGSILASL Sbjct: 171 LFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 9/81 (11%) Frame = +2 Query: 257 LYANTVMSGGTTMYPGIADRMQKEITALAPST-------IK-IKIIAPP-ERKYSVWIGG 409 L N V+ GGT M PG R+ +EI L S IK +K+ PP + W+GG Sbjct: 77 LAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGG 136 Query: 410 SILASLSTFQQMWISKEEYDE 472 +I SL ++E Y + Sbjct: 137 AIFGSLEVLADRSTTRERYQQ 157 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEM 62 IVRDIKEKLCYVALDF QE+ Sbjct: 87 IVRDIKEKLCYVALDFYQEI 106 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 153 PEALFQPSFLGMESCGIHETV 215 PE +FQPS LG+E GI ET+ Sbjct: 3 PEIIFQPSMLGLEQAGITETM 23 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 304 YRRQDAEGDHRPRALDHQDQDHRSPREE 387 +RRQDA DHR + DH QD PR++ Sbjct: 664 HRRQDA--DHRRQDADHHRQDVVHPRQD 689 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 414 MDPPIHTEYFLSGGAMILILMVEGARAVISFCILSAIPGYMV-VPPD 277 +DPP+ +Y L+GG ++ ++ FCI G++V PP+ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCIFQ---GFVVPTPPE 801 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 266 NTVMSGGTTMYPGIADRMQKEITALAP 346 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_10094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 263 ANTVMSGGTTMYPGIADRMQKEITALAP-STIKIKIIAPPE 382 AN V+ + + +R+ KE+ L +K KIIAPPE Sbjct: 44 ANPVIHPARKVPVSLGERLDKELNRLTELGIVKEKIIAPPE 84 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 18 KEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPE 158 +EK+ L+ E E A + LEK +L + +G+ER RC + Sbjct: 2983 REKIVTSDLESELETERALQANELEKQNKLLEKLSADLGHERSRCED 3029 >SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) Length = 423 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -1 Query: 613 RCSVLRYH*VQRTDGCVQNSDEHNTTQHRGHAGALLEALAVDDAGAGLV 467 R V+ H VQR + ++ +E QHR H ++E +D G + Sbjct: 115 RMKVINSHKVQRMEQAKKHKEEIEKNQHRPHHIPIVEKTNEEDKEVGRI 163 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +3 Query: 3 IVRDIKEKLCYVALDFEQEMATA---AASTSLEKSYELPD 113 ++ +KE CYV+ F ++M A ++ + Y LPD Sbjct: 395 VINQVKEDTCYVSSQFYKDMEIARQRGKENTIVREYVLPD 434 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,341,157 Number of Sequences: 59808 Number of extensions: 384902 Number of successful extensions: 1218 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1213 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -