Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10552
         (731 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY748845-1|AAV28191.1|  102|Anopheles gambiae cytochrome P450 pr...    25   1.8  
AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.        25   2.4  
AY045760-4|AAK84945.1|  165|Anopheles gambiae D7-related 4 prote...    25   2.4  
AJ302659-1|CAC35524.1|  165|Anopheles gambiae D7r4 protein protein.    25   2.4  
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    23   7.4  
EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.         23   7.4  
EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.         23   7.4  

>AY748845-1|AAV28191.1|  102|Anopheles gambiae cytochrome P450
           protein.
          Length = 102

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +1

Query: 163 YLLHENNFTFWRPSQFRRNRREPRFTS*CPTSSI-YGGFARSCVAK 297
           Y+LH N   F  P QFR  R     T   P + I +   +R+C+ +
Sbjct: 14  YMLHHNPEYFPEPDQFRPERFADGETKRNPFAYIPFSAGSRNCIGQ 59


>AY578804-1|AAT07309.1|  133|Anopheles gambiae maverick protein.
          Length = 133

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -3

Query: 609 SPPLEVDLPASSKRCFRRSLLVFF 538
           SPP      A +KRC R  LLV F
Sbjct: 19  SPPKTTACTAGNKRCCRHPLLVDF 42


>AY045760-4|AAK84945.1|  165|Anopheles gambiae D7-related 4 protein
           protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = +1

Query: 460 RFQCNIRVCFGKCVPVTVAVRTH 528
           R   N+  C G+CV V  + R H
Sbjct: 90  RHDVNLEKCIGECVQVPTSERAH 112


>AJ302659-1|CAC35524.1|  165|Anopheles gambiae D7r4 protein protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.4
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = +1

Query: 460 RFQCNIRVCFGKCVPVTVAVRTH 528
           R   N+  C G+CV V  + R H
Sbjct: 90  RHDVNLEKCIGECVQVPTSERAH 112


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 22/64 (34%), Positives = 27/64 (42%)
 Frame = -3

Query: 672 AAEPLVTVRVAASLVFGSIRRSPPLEVDLPASSKRCFRRSLLVFFVYRMRPNRDSNRYAF 493
           AA    +V  A+SL+       P LE+ LP+S  R  R    V       PN  S RY F
Sbjct: 224 AAAACSSVYPASSLLLPQDAHHPALEIALPSSLFRASR----VRNELPSAPNSLSVRYNF 279

Query: 492 SKAD 481
              D
Sbjct: 280 RLTD 283


>EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


>EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 699 WHLLHQYHH 673
           WHL H+Y H
Sbjct: 31  WHLFHEYEH 39


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 784,855
Number of Sequences: 2352
Number of extensions: 16984
Number of successful extensions: 119
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 118
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 119
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)