BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10551 (528 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y11119-1|CAA72004.1| 120|Drosophila melanogaster S20 ribosomal ... 133 1e-31 AY071742-1|AAL49364.1| 120|Drosophila melanogaster RH47995p pro... 133 1e-31 AE014297-2870|AAF55809.1| 120|Drosophila melanogaster CG15693-P... 133 1e-31 AY071353-1|AAL48975.1| 120|Drosophila melanogaster RE38972p pro... 132 4e-31 >Y11119-1|CAA72004.1| 120|Drosophila melanogaster S20 ribosomal protein protein. Length = 120 Score = 133 bits (322), Expect = 1e-31 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +2 Query: 239 KGPSPLPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGV 418 KGP +PTK LRITTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGV Sbjct: 53 KGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGV 112 Query: 419 EVEVTIAD 442 EVEVTIA+ Sbjct: 113 EVEVTIAN 120 Score = 81.8 bits (193), Expect = 5e-16 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = +3 Query: 102 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVR 254 KDIEKP + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVR Sbjct: 6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVR 57 >AY071742-1|AAL49364.1| 120|Drosophila melanogaster RH47995p protein. Length = 120 Score = 133 bits (322), Expect = 1e-31 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +2 Query: 239 KGPSPLPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGV 418 KGP +PTK LRITTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGV Sbjct: 53 KGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGV 112 Query: 419 EVEVTIAD 442 EVEVTIA+ Sbjct: 113 EVEVTIAN 120 Score = 81.8 bits (193), Expect = 5e-16 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = +3 Query: 102 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVR 254 KDIEKP + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVR Sbjct: 6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVR 57 >AE014297-2870|AAF55809.1| 120|Drosophila melanogaster CG15693-PA protein. Length = 120 Score = 133 bits (322), Expect = 1e-31 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = +2 Query: 239 KGPSPLPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGV 418 KGP +PTK LRITTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGV Sbjct: 53 KGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGV 112 Query: 419 EVEVTIAD 442 EVEVTIA+ Sbjct: 113 EVEVTIAN 120 Score = 81.8 bits (193), Expect = 5e-16 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = +3 Query: 102 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVR 254 KDIEKP + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVR Sbjct: 6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVR 57 >AY071353-1|AAL48975.1| 120|Drosophila melanogaster RE38972p protein. Length = 120 Score = 132 bits (318), Expect = 4e-31 Identities = 60/68 (88%), Positives = 65/68 (95%) Frame = +2 Query: 239 KGPSPLPTKILRITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGV 418 +GP +PTK LRITTRKTPCGEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGV Sbjct: 53 EGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGV 112 Query: 419 EVEVTIAD 442 EVEVTIA+ Sbjct: 113 EVEVTIAN 120 Score = 77.0 bits (181), Expect = 1e-14 Identities = 38/52 (73%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +3 Query: 102 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVR 254 KDIEKP + + +H IRITLTSRNVRSLE VC DLINGAK Q LRV+GPVR Sbjct: 6 KDIEKPHVGDSASVHCIRITLTSRNVRSLENVCRDLINGAKNQNLRVEGPVR 57 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,168,827 Number of Sequences: 53049 Number of extensions: 483712 Number of successful extensions: 1226 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1970722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -