BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10543 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.2 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.2 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.0 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 5.0 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 8.8 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 8.8 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 8.8 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 8.8 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 63 WVDNLLLNTFFTALRQAFIF 4 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 63 WVDNLLLNTFFTALRQAFIF 4 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 260 D*LNLRKDLSASVSACRSARE 198 D LNLR D+S+S S+ S+ E Sbjct: 363 DILNLRTDISSSSSSISSSEE 383 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 90 QGSVYVQQEASRHH--ACQPYPGNENCFG 170 Q S+Y+QQ+ +HH + + N+ FG Sbjct: 94 QHSLYLQQQQQQHHQDSSSEHASNQERFG 122 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 226 DAERSFRKFS*SPNMCKDVMCSATSTAWTSQPI 324 DA+ S + +S + + K+ A +W +PI Sbjct: 579 DAKSSVQNYSLAKHQLKEAFVKAHLGSWVKKPI 611 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 683 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 591 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 683 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 591 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 635 GCKHRAEGRC 606 GC R EGRC Sbjct: 132 GCGERTEGRC 141 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 635 GCKHRAEGRC 606 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 635 GCKHRAEGRC 606 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 8.8 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 597 AFSMSLAMES-GINLFTTSLSSELVTSRVM 511 A S+S E G +L T+LSS LV SRV+ Sbjct: 599 ASSVSAGEEGLGNSLAITALSSILVLSRVI 628 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,808 Number of Sequences: 438 Number of extensions: 4349 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -