BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10541 (512 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 1.4 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 1.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 5.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 7.5 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 7.5 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 1.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 267 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 386 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.4 bits (48), Expect = 1.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 267 HWSRLTTTKSLENGLVSARLTRMARQGKLSAAPVLSSKIS 386 HWSR T SL+N +S ++ + Q L P +S I+ Sbjct: 22 HWSRGNTWLSLDNSNMS--MSSVGPQSPLDMKPDTASLIN 59 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 70 PDKMGLVGTSTSTSAMVVDY 11 PDK L+G T VDY Sbjct: 447 PDKYDLIGNGTKLIIKNVDY 466 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 138 QDHHGLKLSLAPLAV 94 Q HHGL ++ +P +V Sbjct: 808 QSHHGLHINSSPSSV 822 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = -3 Query: 369 TQEQPTIFLALPSL 328 T++Q T+F+A+P + Sbjct: 67 TEQQSTVFVAIPRI 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,150 Number of Sequences: 438 Number of extensions: 2315 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -