BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10541 (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32060.3 68415.m03918 40S ribosomal protein S12 (RPS12C) 89 2e-18 At2g32060.2 68415.m03917 40S ribosomal protein S12 (RPS12C) 89 2e-18 At2g32060.1 68415.m03916 40S ribosomal protein S12 (RPS12C) 89 2e-18 At1g15930.2 68414.m01912 40S ribosomal protein S12 (RPS12A) simi... 85 2e-17 At1g15930.1 68414.m01911 40S ribosomal protein S12 (RPS12A) simi... 85 2e-17 At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / th... 32 0.20 At5g45640.1 68418.m05612 subtilase family protein contains Pfam ... 27 5.6 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 27 5.6 At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / lon... 27 9.8 At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containi... 27 9.8 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 27 9.8 >At2g32060.3 68415.m03918 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 89.0 bits (211), Expect = 2e-18 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +2 Query: 257 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYL 427 H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L Sbjct: 85 HSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHL 141 Score = 71.3 bits (167), Expect = 3e-13 Identities = 31/59 (52%), Positives = 46/59 (77%) Frame = +3 Query: 75 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALC 251 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALC 82 >At2g32060.2 68415.m03917 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 89.0 bits (211), Expect = 2e-18 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +2 Query: 257 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYL 427 H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L Sbjct: 85 HSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHL 141 Score = 71.3 bits (167), Expect = 3e-13 Identities = 31/59 (52%), Positives = 46/59 (77%) Frame = +3 Query: 75 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALC 251 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALC 82 >At2g32060.1 68415.m03916 40S ribosomal protein S12 (RPS12C) Length = 144 Score = 89.0 bits (211), Expect = 2e-18 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = +2 Query: 257 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYL 427 H I L+ V + K LGEWAGLCKID +G ARK+VGCSC+VIKDFGEET AL+++K +L Sbjct: 85 HSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHL 141 Score = 71.3 bits (167), Expect = 3e-13 Identities = 31/59 (52%), Positives = 46/59 (77%) Frame = +3 Query: 75 NMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALC 251 +MDV+ AL+ ++ + +GG+V GLHE+AK ++KR A LCVLAE+C++ Y KLV+ALC Sbjct: 24 DMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALC 82 >At1g15930.2 68414.m01912 40S ribosomal protein S12 (RPS12A) similar to 40S ribosomal protein S12 GI:4263712 from [Arabidopsis thaliana] Length = 144 Score = 85.4 bits (202), Expect = 2e-17 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = +2 Query: 257 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYL 427 H++ L+ V + K LGEWAGLCKID +G ARK+VGCSC+V+KDFGEET AL ++ ++ Sbjct: 85 HEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSIVNKHI 141 Score = 68.5 bits (160), Expect = 2e-12 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +3 Query: 27 ADVEVEVPT-NPILSGNNMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLA 203 A V V P P +MD+ AL+ L+ A +GG+V GLHE AK ++KR A L VLA Sbjct: 7 APVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLA 66 Query: 204 ENCDEAAYKKLVQALCNNIRFHWSRLTTTKS 296 E+C++ Y KLV+ALC + H RL T S Sbjct: 67 EDCNQPDYVKLVKALCAD---HEVRLLTVPS 94 >At1g15930.1 68414.m01911 40S ribosomal protein S12 (RPS12A) similar to 40S ribosomal protein S12 GI:4263712 from [Arabidopsis thaliana] Length = 144 Score = 85.4 bits (202), Expect = 2e-17 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = +2 Query: 257 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEETPALDVLKDYL 427 H++ L+ V + K LGEWAGLCKID +G ARK+VGCSC+V+KDFGEET AL ++ ++ Sbjct: 85 HEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSIVNKHI 141 Score = 68.5 bits (160), Expect = 2e-12 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 1/91 (1%) Frame = +3 Query: 27 ADVEVEVPT-NPILSGNNMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLA 203 A V V P P +MD+ AL+ L+ A +GG+V GLHE AK ++KR A L VLA Sbjct: 7 APVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLA 66 Query: 204 ENCDEAAYKKLVQALCNNIRFHWSRLTTTKS 296 E+C++ Y KLV+ALC + H RL T S Sbjct: 67 EDCNQPDYVKLVKALCAD---HEVRLLTVPS 94 >At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative similar to SP|O04630 Threonyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) {Arabidopsis thaliana}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain, PF02824: TGS domain Length = 458 Score = 32.3 bits (70), Expect = 0.20 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 168 LDKRQAVLCVLAENCDEAAYKKLVQALCNNIRFHWSRLTTTKSLENGLVSAR 323 L RQA++C L+E+C ++Y K VQ N + ++ + +SL + AR Sbjct: 355 LSPRQAIVCSLSEDC--SSYAKQVQKQINEVGYYVDIDESDRSLRKKVADAR 404 >At5g45640.1 68418.m05612 subtilase family protein contains Pfam domain, PF00082: Subtilase family; contains Pfam domain, PF02225: protease associated (PA) domain Length = 754 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 192 IVLLASCQEL*RLREDRAQDHHGLKLSLAP 103 + LLASC + +LRE+RA +G L P Sbjct: 18 VPLLASCTKEKQLREERASSINGFAAELTP 47 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 27.5 bits (58), Expect = 5.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 391 GNSSVGCAQGLPQVVELILRCNANPY 468 G SS+ C G ++ +++ N NPY Sbjct: 233 GVSSINCGDGFSGIIRIVVLPNPNPY 258 >At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl-CoA synthetase (MF7P) from Brassica napus [gi:1617270] Length = 666 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 103 SCSATFTSMLLPDKMGLVGT 44 SC+ TF S LPD++G++GT Sbjct: 423 SCAGTFVS--LPDELGMLGT 440 >At2g02980.1 68415.m00250 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 603 Score = 26.6 bits (56), Expect = 9.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 287 NKKLGEWAGLCKIDKDGKARKIVGCSCVVIKDFGEE 394 NKK L K+ KD KA K+ GCS + + + E Sbjct: 446 NKKWEYVDSLRKVMKDRKAVKVPGCSSIEVNNVVHE 481 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 26.6 bits (56), Expect = 9.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 130 PWIKAVFSTSCSATFTSMLLPDKMGLVGTSTS 35 PW+K + +TS S+ +S LP+ + + G S S Sbjct: 134 PWLKHLSTTSSSSASSSSRLPNYLYIPGGSIS 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,572,295 Number of Sequences: 28952 Number of extensions: 204985 Number of successful extensions: 639 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -