BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10539 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 23 3.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 3.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.1 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 6.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 6.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.9 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 8.9 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 8.9 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 185 LVPVLLNNVINKCPAIMLAVNRTV 256 L+P +LNN N+C + + + T+ Sbjct: 56 LLPEVLNNHCNRCTSRQIGIANTL 79 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 333 TRNTLYFNTIYSNY*NHQKYYS 268 + T++ N Y+NY N + YY+ Sbjct: 308 SNKTIHNNNNYNNYNNKKLYYN 329 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 363 YKSHIYSYNSTRNTLYFNTIYSNY*NHQK--YYSTWN 259 + ++ Y YN N N +NY N+ K YY+ N Sbjct: 324 HNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIIN 360 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 372 N*KYKSHIYSYNSTRNTLYFNTIYSNY*NHQKYY 271 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 372 N*KYKSHIYSYNSTRNTLYFNTIYSNY*NHQKYY 271 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 345 SYNSTRNTLYFNTIYSNY 292 S+ T N YF+ Y NY Sbjct: 209 SWRITHNFFYFDPRYGNY 226 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 586 NVANQFTPLRSAWLVASNGTKCASKCGLCQKLLDSTN 696 N A + P LVA + +C S+ G Q +D + Sbjct: 24 NAAPDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVD 60 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 586 NVANQFTPLRSAWLVASNGTKCASKCGLCQKLLDSTN 696 N A + P LVA + +C S+ G Q +D + Sbjct: 24 NAAPDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVD 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,932 Number of Sequences: 438 Number of extensions: 2833 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -