BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10536X (580 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 25 0.71 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 25 0.71 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 25 0.71 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 25 0.71 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 0.71 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.71 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 0.71 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.71 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.71 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.71 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.9 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 22 3.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 3.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 5.0 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 6.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 8.8 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 86 SNNYNYNNYNNNYKPLYY 103 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 86 SNNYNYNNYNNNYKPLYY 103 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 86 SNNYNYNNYNNNYKPLYY 103 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 86 SNNYNYNNYNNNYKPLYY 103 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 319 SNNYNYNNYNNNYKPLYY 336 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 319 SNNYNYNNYNNNYKPLYY 336 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 319 SNNYNYNNYNNNYKPLHY 336 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 319 SNNYNYNNYNNNYKPLYY 336 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 319 SNNYNYNNYNNNYKPLYY 336 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTF 243 SN NY NYN NY P + Sbjct: 308 SNNYNYNNYNNNYKPLYY 325 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTFKKKIQGIQFYPI 207 SN NY NYN NY I I+ P+ Sbjct: 306 SNNYNYKNYNNNYNSKKLYYNIINIEQIPV 335 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTFKKKIQGIQFYPI 207 SN NY NYN NY I I+ P+ Sbjct: 317 SNNYNYKNYNNNYNSKKLYYNIINIEQIPV 346 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 353 MIFFICLCNSSINP 312 ++F++ CNS+INP Sbjct: 46 VLFWLGYCNSAINP 59 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 353 MIFFICLCNSSINP 312 ++F++ CNS+INP Sbjct: 494 VLFWLGYCNSAINP 507 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 5.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -3 Query: 326 SSINPK*IRRSNCLN---YINYNFNYLPFTFKKKIQGIQFYPIN 204 SS++ K I +N N Y NYN+N + KK+ +Y IN Sbjct: 83 SSLSNKTIHNNNNYNNNNYNNYNYNNNNYNNYKKL----YYNIN 122 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 515 LSKFLFNPKGLLDPVW 562 L + F+ +GLL PVW Sbjct: 213 LEELGFDTEGLLPPVW 228 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 296 SNCLNYINYNFNYLPFTFKKKI 231 SN NY N N+ Y + KK+ Sbjct: 319 SNNYNYNNNNYKYNYNNYNKKL 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,383 Number of Sequences: 438 Number of extensions: 1360 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -