BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10536X (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) conta... 73 1e-13 >At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) contains Pfam profile PF00033: Cytochrome b(N-terminal)/b6/petB; ontains Pfam profile PF00032: Cytochrome b(C-terminal)/b6/petD; 99% identical to apocytochrome B (GI:6851014), cytochrome b (GI:402962), and Cytochrome b (Swiss-Prot:P42792) [Arabidopsis thaliana] Length = 393 Score = 73.3 bits (172), Expect = 1e-13 Identities = 36/75 (48%), Positives = 44/75 (58%) Frame = -1 Query: 511 SFHPFFTFKDXXXXXXXXXXXXXXXXINPYLLGDPDNFTPANPLVTPVHIQPE*YFLFAY 332 +F+P+F KD P +LG PDN+ PANP+ TP HI PE YFL + Sbjct: 226 AFYPYFYVKDLVGWVAFAIFFSIWIFYAPNVLGHPDNYIPANPMSTPPHIVPEWYFLPIH 285 Query: 331 AILRSIPNKLGGVIA 287 AILRSIP+K GGV A Sbjct: 286 AILRSIPDKAGGVAA 300 Score = 30.7 bits (66), Expect = 0.73 Identities = 18/66 (27%), Positives = 26/66 (39%) Frame = -3 Query: 257 LPFTFKKKIQGIQFYPINQXXXXXXXXXXXXXXXIGARPVENPYIITGQXXXXXXXXXXX 78 LPF ++ F PI+Q IG +PVE P++ GQ Sbjct: 311 LPFFKSMYVRSSSFRPIHQGMFWLLLADCLLLGWIGCQPVEAPFVTIGQISPLVFFLFFA 370 Query: 77 LNPIIG 60 + PI+G Sbjct: 371 ITPILG 376 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,719,205 Number of Sequences: 28952 Number of extensions: 86171 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -