BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10535 (554 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.19 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.1 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 3.1 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 5.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 26.2 bits (55), Expect = 0.19 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -1 Query: 545 FFFCVKQNHNYTFDYTINGLRCCYLIIVGMHFLQFWVLDNVTL 417 F C+ +T++ L CC I MH L LD TL Sbjct: 162 FLLCIYHFFCAFIIFTMHLLFCCAFIFFNMHLLFLLCLDYFTL 204 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 503 YTINGLRCCYLIIVGMHFL 447 Y ++ L CC II MH L Sbjct: 262 YYMHLLFCCAFIIFTMHLL 280 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.1 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 492 WIKVLLFDYRGH 457 WI V+ +D+ GH Sbjct: 2507 WIAVMTYDFHGH 2518 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 492 WIKVLLFDYRG 460 WI V+ +DY G Sbjct: 2009 WIAVMCYDYHG 2019 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 284 VNDQYKRLG*PRREQILPTLSGSTTLVPNDLVA 186 ++++ RL R + L+G TLV ND+VA Sbjct: 214 ISEKIVRLEAVWRSGVFAPLTGVGTLVVNDVVA 246 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 5.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -3 Query: 255 TKEGADFTYFIRVHDFSTQRPCC 187 T GA TY ++ F +P C Sbjct: 646 TVVGAATTYITIIYQFQVNKPTC 668 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,756 Number of Sequences: 336 Number of extensions: 2998 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -