BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10532 (592 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 1.0 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 1.8 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 1.8 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 24 4.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.8 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 433 AREAVRHFGPAPGAPRSHTKPYV 501 A E +R + PAP R+ TKPY+ Sbjct: 387 ANETLRKWTPAPFLDRTCTKPYM 409 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -3 Query: 260 VTSPLPRQSNPHELASSCGAPNETQRLVAG*YGS*RAGVERSD*IWH 120 VT+PLP S P L PN +Q G + +G+ R +H Sbjct: 352 VTAPLPGPSPPSSLGMPGNIPNLSQLDATGGQSASTSGLPRGIYTYH 398 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.0 bits (52), Expect = 1.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 228 SRVGFFMWRAKRDTEIGGRLIRLIKSRRRTI 136 +RVG +W +K E R + IKS+RR + Sbjct: 266 ARVGLELWGSKSIGECTQRQLDNIKSKRRVV 296 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 460 PAPGAPRSHTKPYVRTRDMKKQGPVVVLM 546 P P +PRS T+P R ++++ V+VL+ Sbjct: 2 PLPRSPRSRTRP---ARGVRREPAVLVLV 27 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 22.6 bits (46), Expect = 9.8 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 421 LVPVLSSCQSEHEEPADQK*EFLLQQPKCVHELF 320 ++P + Q EH+ PA Q+ LLQQ + L+ Sbjct: 1322 IIPDMDLQQMEHQTPAQQQ---LLQQGAACNVLY 1352 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,244 Number of Sequences: 2352 Number of extensions: 12583 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -