BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10530 (794 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 26 0.46 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 26 0.46 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 26 0.46 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.3 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 4.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.7 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 10.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 10.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 10.0 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 25.8 bits (54), Expect = 0.46 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 636 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKSIR 737 L +PLD ++ +E+F ++HAG+++R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 25.8 bits (54), Expect = 0.46 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 636 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKSIR 737 L +PLD ++ +E+F ++HAG+++R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 25.8 bits (54), Expect = 0.46 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 636 LEKKLPLDEFVTHNVPLKEINEAFHLMHAGKSIR 737 L +PLD ++ +E+F ++HAG+++R Sbjct: 173 LISSIPLDYIFLIFNQFQDFSESFQILHAGRALR 206 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 351 KFIDSKFLSYLKLVRVDVNTNNAIGTC 271 + D +Y KLVR VNT++ + C Sbjct: 31 RLYDDLLSNYNKLVRPVVNTSDVLRVC 57 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 351 KFIDSKFLSYLKLVRVDVNTNNAIGTC 271 + D +Y KLVR VNT++ + C Sbjct: 31 RLYDDLLSNYNKLVRPVVNTSDVLRVC 57 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 367 YDKPIQQVLVDLTDGGLEYTFECIGN 444 +D+ Q+V+ G LE F C+GN Sbjct: 140 FDQLGQEVIYTACVGLLERAFRCLGN 165 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 4.3 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -2 Query: 448 LHFQYIQKCILDHHQSNPPV 389 L +Y+++C+L+ + PPV Sbjct: 395 LEMKYLERCLLETLRMYPPV 414 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 491 PHPLWQASSAALMVPTFPIHSKVYSR 414 PH WQ S+A L+ F ++V R Sbjct: 105 PHMAWQLSTAHLLAQLFLKSTEVTPR 130 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 10.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 68 FSQYTVVLEISLCKV 112 + QY VL +SLCK+ Sbjct: 102 WQQYPWVLGVSLCKI 116 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 304 NPDKFEVAKKFGVNEFVNPKDYDKP 378 N E +FG + +N K+YD P Sbjct: 17 NSASLENDNEFGFSYLLNCKNYDHP 41 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 10.0 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +2 Query: 374 NQFNKYWW 397 N+ NK+WW Sbjct: 361 NEMNKWWW 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,146 Number of Sequences: 438 Number of extensions: 4771 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -