BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10527 (837 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 2.6 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 8.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 8.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 8.1 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.4 bits (48), Expect = 2.6 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 573 LTCICEDPTAAWNQLLYQEKLSIHKLQCLSTYSNISVNLFN 451 LT C D A WN L Q L + ++ + +S + +L N Sbjct: 431 LTMSCSDKIARWNVLGVQGALLSYFIEPIYFHSIVLGSLLN 471 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 8.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 227 FLFLVYINDYLSLLKPVTRSYYSLMIHHY 313 +LF Y D + K T+ + L I HY Sbjct: 43 YLFCDYDRDIIPEQKNATKIDFGLSIQHY 71 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 732 LQKRAIRAIYICTRGNP*GTSLRKS 806 +QK+ +Y C+ N G S R+S Sbjct: 578 VQKKGDAGVYTCSARNKQGHSARRS 602 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 732 LQKRAIRAIYICTRGNP*GTSLRKS 806 +QK+ +Y C+ N G S R+S Sbjct: 578 VQKKGDAGVYTCSARNKQGHSARRS 602 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,100 Number of Sequences: 438 Number of extensions: 4837 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -