BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10526X (423 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 0.92 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 1.6 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 20 8.6 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 20 8.6 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 20 8.6 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 0.92 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 219 LSIIQEKLGRDKQ-LNEKSPYTTFGMNKFHDYTPEE 323 +S ++ L DK L EK F +FH YTPE+ Sbjct: 470 VSQLKNALSIDKGILREKPDVKIFLPFRFHIYTPED 505 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.6 bits (46), Expect = 1.6 Identities = 19/71 (26%), Positives = 27/71 (38%) Frame = -1 Query: 342 IRTCSAVPQEYNHEICSCQT*YMDSSRSIVYLCQVFLE*LIMQLSVGIILVFPVMFFDDT 163 I TCS V E + C Y D + L L Q++ I + FFD + Sbjct: 275 IMTCSGVHSESQKLVGVCYE-YQDRFSDESKKRRELLR-LAQQVNANIAQITAANFFDIS 332 Query: 162 LEQFFGLIEVI 130 F G++ I Sbjct: 333 RSTFLGILATI 343 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 20.2 bits (40), Expect = 8.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 98 AITTVAINNATLTKFIFAQCINSGTGLLVPS 6 A+TT + TL F +C N+ +L P+ Sbjct: 497 ALTTRELPGETLRLFTCMECPNNYPWILEPT 527 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 20.2 bits (40), Expect = 8.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 374 PTSVYRNAIPDEI 412 PT +Y+N DE+ Sbjct: 108 PTGIYKNKYADEL 120 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 20.2 bits (40), Expect = 8.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 374 PTSVYRNAIPDEI 412 PT +Y+N DE+ Sbjct: 108 PTGIYKNKYADEL 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,796 Number of Sequences: 336 Number of extensions: 1710 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -