BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10526X (423 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 25 0.35 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 1.1 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 23 1.9 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 4.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 5.7 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 20 10.0 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 20 10.0 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 20 10.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 20 10.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 20 10.0 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 20 10.0 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 20 10.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 20 10.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 20 10.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 20 10.0 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 20 10.0 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 20 10.0 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 20 10.0 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 20 10.0 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 20 10.0 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 20 10.0 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 20 10.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 10.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 10.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 10.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 10.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 10.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 25.0 bits (52), Expect = 0.35 Identities = 11/45 (24%), Positives = 27/45 (60%) Frame = +1 Query: 118 PPRHYDLNQAKELFESIVKEHNREYKDDADRELHYQSFKKNLAEI 252 P ++LN ++ E + +++R + +DR + ++ KKNL+++ Sbjct: 317 PELQHNLNILVDMCEQDIIQNDRRTRHLSDRVVALEAEKKNLSKV 361 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 1.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 66 CGVVNSHSSNGVIGG 110 CGV N H G++GG Sbjct: 329 CGVHNLHGMPGILGG 343 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 75 VNSHSSNGVIGGYRSS 122 V+SHSSNG+ G+ S Sbjct: 76 VSSHSSNGIHTGFGGS 91 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 4.3 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 163 SIVKEHNREYKD-DADRELHYQSFKKNLAE 249 S K+ NREYK+ D E Y +K L E Sbjct: 3 SCSKDRNREYKEKDRRYEKLYNEKEKLLEE 32 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 5.7 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 97 ASSADTDPPRHYDLNQAKELFE---SIVKEHNREYKDDADRELHYQSFKKNLAE 249 A+S+++ R +D + S ++ NREYK+ R + K+ L E Sbjct: 211 ATSSNSLRSRTHDFQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLE 264 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 3 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 31 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 20.2 bits (40), Expect = 10.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 179 ITGNTRMMPTESCI 220 IT + R++PT +CI Sbjct: 385 ITESLRLIPTTTCI 398 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 10.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 Query: 211 LCRHHPCIPC 182 LC HH +PC Sbjct: 1097 LCLHHRDLPC 1106 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 225 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 253 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 236 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 264 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 163 SIVKEHNREYKDDADRELHYQSFKKNLAE 249 S ++ NREYK+ R + K+ L E Sbjct: 236 SCSRDRNREYKEKDRRYEKLHNEKEKLLE 264 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 10.0 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = -2 Query: 116 SVSADDAITTVAINNATLTKFIFAQCINSGTGLL 15 S S ITT T T A + TGL+ Sbjct: 100 STSLPATITTTTTTTTTTTATAAATATTTATGLI 133 Score = 20.2 bits (40), Expect = 10.0 Identities = 8/36 (22%), Positives = 17/36 (47%) Frame = +1 Query: 112 TDPPRHYDLNQAKELFESIVKEHNREYKDDADRELH 219 T PP +++A E ++ + + +RE+H Sbjct: 1395 TSPPTPLSISRAGSRDEDSTRDSTKLDRSSREREVH 1430 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,313 Number of Sequences: 438 Number of extensions: 2489 Number of successful extensions: 34 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10873896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -