Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10525
         (737 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00451-1|CAA68506.1|  642|Homo sapiens protein ( Human mRNA for ...    33   1.1  

>Y00451-1|CAA68506.1|  642|Homo sapiens protein ( Human mRNA for
           5-aminolevulinate synthase. ).
          Length = 642

 Score = 33.1 bits (72), Expect = 1.1
 Identities = 15/38 (39%), Positives = 19/38 (50%)
 Frame = -3

Query: 150 LSHCLHYYILHSVKVFHSPQYFLKDKSHIGDDHCLHVF 37
           +SH LH  +  SV  FH  ++F K      DDH   VF
Sbjct: 184 VSHLLHDNLPKSVSTFHYDRFFEKKSDEKNDDHTYRVF 221


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,137,335
Number of Sequences: 237096
Number of extensions: 1867346
Number of successful extensions: 1986
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1878
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1974
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8791154398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)