BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10525 (737 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113432-1|AAM29437.1| 61|Drosophila melanogaster RE25290p pro... 29 5.0 AY070864-1|AAO25041.1| 80|Drosophila melanogaster HL02010p pro... 29 5.0 >AY113432-1|AAM29437.1| 61|Drosophila melanogaster RE25290p protein. Length = 61 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 207 PFPCLYVVHTYIYNKILLYLSHCLHYYILH 118 PF C+ T+IYN +LL C+ Y +L+ Sbjct: 14 PFGCVSRSRTFIYNFLLLCTGFCVVYILLY 43 >AY070864-1|AAO25041.1| 80|Drosophila melanogaster HL02010p protein. Length = 80 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 207 PFPCLYVVHTYIYNKILLYLSHCLHYYILH 118 PF C+ T+IYN +LL C+ Y +L+ Sbjct: 3 PFGCVSRSRTFIYNFLLLCTGFCVVYILLY 32 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,987,086 Number of Sequences: 53049 Number of extensions: 564006 Number of successful extensions: 847 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3334818762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -