BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10523 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 28 0.37 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 0.85 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 27.9 bits (59), Expect = 0.37 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 287 CRRYPLLTSFVHFFYDINVRPKR-RVLACAFPCPV 186 C RYPL F F +D + PKR CA C + Sbjct: 19 CCRYPLTVDFEKFGWDWIIAPKRYEAWYCAGECMI 53 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.6 bits (56), Expect = 0.85 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 403 FCELFYFYTNSYVQFIIITVHKQNIHNICSYKTNC 299 +C+L Y SY+ I + H +CSY T+C Sbjct: 746 YCKLMYNRERSYIPLI----EAEPKHFLCSYNTHC 776 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,459 Number of Sequences: 2352 Number of extensions: 13285 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -