BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10523 (773 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70735-1|AAD03469.1| 297|Homo sapiens 34 kDa Mov34 homolog prot... 72 3e-12 BC002520-1|AAH02520.2| 327|Homo sapiens COP9 constitutive photo... 72 3e-12 >U70735-1|AAD03469.1| 297|Homo sapiens 34 kDa Mov34 homolog protein. Length = 297 Score = 71.7 bits (168), Expect = 3e-12 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 53 TSQQFRTHFYNQCNDVALMTYLGTITKGCNAINQLVNRFKVLYD 184 ++ +F+T FY+QCNDV LM YLGTITK CN +NQ VN+F VLYD Sbjct: 241 STDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYD 284 >BC002520-1|AAH02520.2| 327|Homo sapiens COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis) protein. Length = 327 Score = 71.7 bits (168), Expect = 3e-12 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 53 TSQQFRTHFYNQCNDVALMTYLGTITKGCNAINQLVNRFKVLYD 184 ++ +F+T FY+QCNDV LM YLGTITK CN +NQ VN+F VLYD Sbjct: 271 STDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYD 314 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,752,143 Number of Sequences: 237096 Number of extensions: 1716145 Number of successful extensions: 4126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4126 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9367263024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -