BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10519 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 126 1e-30 EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. 25 1.9 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 126 bits (303), Expect = 1e-30 Identities = 56/83 (67%), Positives = 64/83 (77%) Frame = +1 Query: 259 KGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVILVD 438 KG TYGKPKSHGVNQLKP R LQS+AEE +SYWVAQD+++KYFEVI+VD Sbjct: 77 KGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYWVAQDAAHKYFEVIMVD 136 Query: 439 PSHKAIRRDPKINWIVNAVHKHR 507 P + AIRRDP +NWI NAVHKHR Sbjct: 137 PPNNAIRRDPNVNWICNAVHKHR 159 Score = 104 bits (249), Expect = 3e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +2 Query: 32 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAK 199 MGAYRY+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAK 56 Score = 70.9 bits (166), Expect = 4e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +3 Query: 510 MRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 641 +RGLTSAG+SSRGLGK +RYSQT GGSRRAA +RRN L LRR R Sbjct: 161 LRGLTSAGKSSRGLGKAYRYSQTIGGSRRAAGVRRNRLHLRRYR 204 >EF492429-1|ABP35929.1| 155|Anopheles gambiae lysozyme i-2 protein. Length = 155 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 575 LRVSMSLAETSGAATSRSQTTHPRCLCTAFT 483 L + +SLA +GA S T RC+C A T Sbjct: 8 LLLLLSLATVNGAFLSNLNATCFRCICDAST 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,780 Number of Sequences: 2352 Number of extensions: 14614 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -