BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10504 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 30 0.061 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.99 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 24 3.0 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 4.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 5.3 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 23 7.0 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 9.3 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 23 9.3 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 9.3 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.3 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 29.9 bits (64), Expect = 0.061 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 284 TRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVPP 427 T RS ST N TIR R TR P P V +R P PP Sbjct: 416 TTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIVYYPARETLPRLAQPP 463 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 0.99 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 35 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 154 N++ R +EE ++M NE+ K + QK+ Q + S Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGS 243 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 24.2 bits (50), Expect = 3.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 292 PPCRPAGWNPATCG 251 PPCR GW +T G Sbjct: 50 PPCRVPGWRLSTSG 63 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 4.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 344 RRCTRVPEESPEVCRASRAEHPEPEVPPP 430 R+C+R SP+ A ++++ P VPPP Sbjct: 44 RKCSR--NGSPKFAPAVQSKNRMPPVPPP 70 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 5.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 386 RASRAEHPEPEVPPPGLEALAPPSRRSIK 472 R H +VPPPG+E P + I+ Sbjct: 1740 RMEEGAHLSFKVPPPGIEFTLPSPKIGIE 1768 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.0 bits (47), Expect = 7.0 Identities = 15/78 (19%), Positives = 31/78 (39%) Frame = +2 Query: 8 NKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED 187 N ++ I D G + E ++ AEKY +D + + ++ + F ++ Sbjct: 46 NPQHTIPTLVDNGHILWESYAILIYLAEKYALDDSLYPKDVCERSIVHQRLFFDSGMFQN 105 Query: 188 EKLKEKISDSDKQTILDK 241 L+ +S I D+ Sbjct: 106 TTLQAVLSHLRNNPITDE 123 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 87 QRSTETRMTSKRRPSRPRMHWNLTASA 167 Q + ET R P+R W+ TA+A Sbjct: 409 QLTEETYQEGTRDPARTPFQWDSTANA 435 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 7 QQGEQDHHYQRQR 45 QQ Q HH+Q QR Sbjct: 110 QQQHQQHHHQHQR 122 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 22.6 bits (46), Expect = 9.3 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -2 Query: 394 GSPAYLRGLLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNPATCGVVA 242 G+ +R L+ G S L +C+ + + + C+ G + GVVA Sbjct: 400 GALELVRALVEPAGGSIELEECERIFVRLYADYPAECKEFGLSDLAAGVVA 450 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 350 CTRVPEESPEVCRASRAEHP 409 C+ VP++S E+ S +HP Sbjct: 741 CSAVPKDSDEIEVISSTQHP 760 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,198 Number of Sequences: 2352 Number of extensions: 10608 Number of successful extensions: 43 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -