BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10503 (838 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.7 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.4 bits (53), Expect = 2.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 254 ETRSFMLLSASVNSISSMPSPVYQCKKALR-LNIAVN 147 +TR+ +L S N+I S+P ++ LR LNI+ N Sbjct: 169 QTRNLEVLDLSTNNIWSLPDHLFCSLSGLRSLNISSN 205 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 211 SRPCPRRCTNARKP 170 + PC R CT RKP Sbjct: 286 NHPCKRACTLGRKP 299 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 8.7 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +3 Query: 12 ILRGMDPQQREDRRVRHSPSWSQDGRHLHWKLHRH--PGA 125 +L QQ++ +++ H PS S HL + H PGA Sbjct: 79 VLSSSAQQQQQQQQLLHHPSSSPHSNHLLGGPNHHLPPGA 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,202 Number of Sequences: 2352 Number of extensions: 16024 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -