Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10493
         (752 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4ZJA8 Cluster: DNA-directed RNA polymerase; n=3; Lymph...    33   7.6  

>UniRef50_Q4ZJA8 Cluster: DNA-directed RNA polymerase; n=3;
            Lymphocystivirus|Rep: DNA-directed RNA polymerase - Fish
            lymphocystis disease virus (FLDV)
          Length = 1018

 Score = 33.1 bits (72), Expect = 7.6
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
 Frame = +1

Query: 130  IITCFTCKVNFRALDLKK--ISHMVKTVNSLILLLDDWKTTFICELNHKELQSPVFVNP 300
            +  C+T K+ + A   K+  ++  +K + +L L L+ W+TT  C L  K+  S +F+ P
Sbjct: 841  LAACYTGKI-YDATPFKRYNLTEELKEL-ALELKLETWETTMYCGLTGKKFSSKIFIGP 897


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,643,834
Number of Sequences: 1657284
Number of extensions: 12602518
Number of successful extensions: 24722
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 23784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24709
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62146450145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)