BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10493 (752 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17502| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_14855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 >SB_17502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = -1 Query: 275 SSLWLSSQINVVFQSSNNNISEFTV----LTMCEIFFKSSALKFTL 150 + +W ++ N VF + N+ TV L +CE +S+L FTL Sbjct: 40 NEIWRRTRANTVFLQESWNMKSITVLLVPLLICEYILSASSLSFTL 85 >SB_14855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/74 (25%), Positives = 35/74 (47%) Frame = -3 Query: 714 KCSNEFYTSFNITILLNNSKEAYFLRLNPLVVHLYYT*KDK*FKLNLNISRLFYCPCKRD 535 K +N+ Y F+ + +NN A + +P + + +Y D K+N + LF K + Sbjct: 56 KINNDHYALFDTSPKINNDHYALLIDTSPKINNDHYALFDTSPKINNDHYALFDTSPKIN 115 Query: 534 TDFIYLYN*SSNLN 493 D L++ S +N Sbjct: 116 NDHYALFDTSPKIN 129 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,420,776 Number of Sequences: 59808 Number of extensions: 392630 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -