BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10493 (752 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 0.82 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 7.7 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.6 bits (56), Expect = 0.82 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +1 Query: 58 GQGISITKFLNTRNQIY*NKIRE*IITCFTCKVNFRALDLKKISHMVKTVNSLILLLDDW 237 G G S FL QI+ ++ II+ V FR+LDL K V+ + L +W Sbjct: 113 GYGSSRNTFLI--GQIFPSQHHIGIISRLNSDVQFRSLDLSKAKTTVRLLKKPPSLDSEW 170 Query: 238 KTT 246 K++ Sbjct: 171 KSS 173 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +3 Query: 312 VGIWLRRYHQENNLFDRDFSYCHVSNHQHYYIPSFSPTP 428 V +W R H E + + H H+ ++ F+P+P Sbjct: 912 VRLWTGRKHGEVDFYLSQVLSGHAFVHEFLHVFGFAPSP 950 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,483 Number of Sequences: 2352 Number of extensions: 14533 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -