BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10487 (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) 83 2e-16 SB_42576| Best HMM Match : VlpA_repeat (HMM E-Value=8.1) 30 1.5 SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) 29 3.6 SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) 28 6.2 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 28 8.2 SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_6677| Best HMM Match : Ribosomal_L1 (HMM E-Value=0.4) Length = 81 Score = 83.0 bits (196), Expect = 2e-16 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +3 Query: 336 SESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKGTIKFQMKKV 485 S+SLIKQIPR+LGPGLNKAGKFP ++H E+M QKI++V+ TIKFQMKK+ Sbjct: 28 SDSLIKQIPRILGPGLNKAGKFPTPINHNENMVQKIEDVRSTIKFQMKKI 77 >SB_42576| Best HMM Match : VlpA_repeat (HMM E-Value=8.1) Length = 325 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 354 QIPRLLGPGLNKAGKFPGLLS--HQESMTQKIDEVKGTIKFQMKKV 485 +IP P +K K+PG ++ HQ + E GTI MK + Sbjct: 30 EIPGYYQPCTSKTSKYPGTMNLVHQRHRNTRTSEYPGTINLVMKDI 75 >SB_50940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 578 AVTQGS*WKDAHSEQAHQESCPH 510 AV+ WK H+ Q QESCPH Sbjct: 103 AVSNPCFWKWIHAHQTAQESCPH 125 >SB_11654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = -1 Query: 249 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 70 W I LV L+ + N + R ++VF + E L+ +W + +T L +Q F+ Sbjct: 296 WFIWTAVLVDALIQANNGSWRRRAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 355 Query: 69 V 67 + Sbjct: 356 L 356 >SB_41172| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-21) Length = 342 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 5/78 (6%) Frame = -1 Query: 285 SYSIFSKPQHHTWHIQGFSLVTMLLVSKNA----NLHFRPRYVF*LYSAGETLVLLWVIV 118 S S++ + TW + S +T+ +S LH R + +F + A L+++W+I Sbjct: 96 SCSLYMSFELSTWLLLMSSFLTLTAISCERFAALTLHLRYQQMFTMKRAAMALIMIWLIS 155 Query: 117 LQTN-LKLYSLQKVTFLV 67 L N ++L L+ + + + Sbjct: 156 LSLNVIRLLLLESLFWCI 173 >SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07) Length = 1286 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 555 PSTSLCHCSRNTGRMSD 605 PS CHC N GRM D Sbjct: 526 PSDPTCHCPSNNGRMKD 542 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +1 Query: 100 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 222 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 >SB_11653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1867 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = -1 Query: 249 WHIQGFSLVTMLLVSKNANLHFRPRYVF*LYSAGETLVLLWVIVLQTNLKLYSLQKVTFL 70 W I LV L+ + N + + ++VF + E L+ +W + +T L +Q F+ Sbjct: 395 WFIWFAVLVDALIQANNGSWRRQAQFVFTILFDIEALIKIWCVGFRTYLNSSRMQFFEFI 454 Query: 69 VLRG 58 + G Sbjct: 455 LAVG 458 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 353 ADSPFVGSRFEQSW*IPWSSLPPGVHDAED 442 +DSP+ G+ + W I S+ P VHD D Sbjct: 725 SDSPYSGNSSGEDWDIYSSAQPTAVHDLPD 754 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +1 Query: 100 LQIGLKNYDPQKDKRFSGTVKLKYIPRPKM-QVC---VLGDQQHC 222 LQ G K YDP K+K K KY+ PK+ + C ++ +QHC Sbjct: 336 LQCGKKFYDPLKEK----CAKNKYVYNPKIYKYCYGRIIPVKQHC 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,005,111 Number of Sequences: 59808 Number of extensions: 459353 Number of successful extensions: 1065 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1063 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -