BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10484 (482 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36470.1 68415.m04476 expressed protein 28 2.9 At4g23530.1 68417.m03391 expressed protein 27 6.6 >At2g36470.1 68415.m04476 expressed protein Length = 327 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -3 Query: 273 LGAGRERDAKRDKSSGGKW----CRRAGGRCWWTSRSSLRD 163 LG G + D +RD SS W R G CW T+++ D Sbjct: 133 LGVG-DVDHERDTSSSSSWRVSKTERFSGTCWLTTKAQFSD 172 >At4g23530.1 68417.m03391 expressed protein Length = 396 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 300 RNGVRS*DRLGAGRERDAKRDKSSGGKWC---RRAGGRCW 190 R R+ L G D +RD++SGG C RR R W Sbjct: 160 RRAKRALTSLLIGLNADERRDRNSGGSGCSNQRRTTSRSW 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,391,324 Number of Sequences: 28952 Number of extensions: 80616 Number of successful extensions: 152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -