BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10481 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 29 2.7 03_02_0090 - 5564326-5567280 28 4.8 >11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 Length = 259 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = +3 Query: 30 DNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN 209 D ++L E + + V+ + NAAK Y E K K ++C F K Sbjct: 47 DKINLEEMLRHAEPEVPMGSVRGLNNFEALQNAAKEVMYDESKGCNKKIVCEFGKVTKKP 106 Query: 210 SDGT 221 S GT Sbjct: 107 SKGT 110 >03_02_0090 - 5564326-5567280 Length = 984 Score = 27.9 bits (59), Expect = 4.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 342 DLEGFIGCVLPGLILALF*YALGFRFINTRGSFLAQHPCSVYHLS 208 DL I LPG I +L +G R++N G+F+ P + HL+ Sbjct: 613 DLSDTIVMALPGEIGSL----VGLRYLNVSGTFIGALPPELLHLT 653 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,369,205 Number of Sequences: 37544 Number of extensions: 203879 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -