BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10473 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 27 0.74 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 4.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.9 AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 23 6.9 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 23 9.1 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 23 9.1 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 26.6 bits (56), Expect = 0.74 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 468 YTQRRCEKWWQLPSFQTYGTKDMCS--CKRIDTCH 370 + + RC+K +Q+PS G +C+ + DTCH Sbjct: 284 FNKERCKKLFQVPSGVGVGLGHICAGGIRDEDTCH 318 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 231 YGLHQLYCQQMGSQSHVN 284 YG+H+L QQ SH+N Sbjct: 657 YGVHELNAQQEIRHSHIN 674 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 509 TEKCS-FLENCEAFFTPNVDAKNGGNFHLFKLMVPKT 402 + +CS LENCEA T + + G++ L P T Sbjct: 760 SNECSDLLENCEAGSTASAECVTNGDYMLQPSNAPFT 796 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 104 MDLAAEKLINKERFNGEN 157 MDLAA +L+ +ERF +N Sbjct: 1852 MDLAAHELMLEERFKRKN 1869 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.4 bits (48), Expect = 6.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 270 DCPFVGNIIDAIHNITPRNILITIRITPIGKYSKNCNA 157 + P +GNI++A + + + T I+P G ++N A Sbjct: 65 ELPKIGNIVNARALLNLGDSVTTDHISPAGSIARNSPA 102 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 420 TYGTKDMCSCKRIDTCHIVRNQHTTSWV 337 T GT + C+ R+D V NQ+ WV Sbjct: 249 TLGTTNTCAFDRLDEIGPVANQYNV-WV 275 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 420 TYGTKDMCSCKRIDTCHIVRNQHTTSWV 337 T GT + C+ R+D V NQ+ WV Sbjct: 280 TLGTTNTCAFDRLDEIGPVANQYNV-WV 306 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,885 Number of Sequences: 2352 Number of extensions: 18766 Number of successful extensions: 35 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -