BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10472 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) 28 7.9 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 651 KYFNYFGSTKCATSNRHFTNRLLLQG 574 KY N +TKCATSNR F N + +G Sbjct: 367 KYSNGIDATKCATSNRCFPNPCINRG 392 >SB_31260| Best HMM Match : rve (HMM E-Value=5.2e-25) Length = 1962 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 311 YTAHYVGTLQLSSG*TNTQKTYLTQKLPGNETSIICE 201 +T ++VG +LS +NT TYL G ++ I E Sbjct: 70 HTVNFVGVQKLSFDGSNTDYTYLAHNFKGYDSYFILE 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,519,668 Number of Sequences: 59808 Number of extensions: 312514 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -