BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10470 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces... 33 0.045 SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 31 0.14 SPBC32H8.06 |mug93||TPR repeat protein, meiotically spliced|Schi... 29 0.42 SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyce... 26 3.9 SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha... 25 6.8 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 25 9.0 SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosa... 25 9.0 >SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 591 Score = 32.7 bits (71), Expect = 0.045 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 514 RGQVYLKLNKPNACIKDCTHALELNCDSAGPY 609 R YLK+ P CI+DC A+EL+ + A Y Sbjct: 439 RAAAYLKVMAPAECIRDCNKAIELDPNFAKAY 470 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 31.1 bits (67), Expect = 0.14 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 428 FSEQKYDEAINLYTAAIQLNPQSALLFLNGDR 523 + E+KY EAI YT AI L SAL +R Sbjct: 34 YKEKKYAEAIKAYTEAIDLGSDSALAIYYSNR 65 >SPBC32H8.06 |mug93||TPR repeat protein, meiotically spliced|Schizosaccharomyces pombe|chr 2|||Manual Length = 383 Score = 29.5 bits (63), Expect = 0.42 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 502 VVSKRGQVYLKLNKPNACIKDCTHALELN 588 V+ +RG YL+L P+ +D H+LEL+ Sbjct: 77 VIWRRGLAYLRLGHPHLANRDWEHSLELD 105 >SPCC330.02 |rhp7|SPCC613.14|Rad7 homolog Rhp7|Schizosaccharomyces pombe|chr 3|||Manual Length = 563 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 207 DFTAAGDKKSSNEEKVNRHLTRNRSLN 287 D A GD N +K+++ +++NRSLN Sbjct: 205 DIEAFGDIGQVNMDKISQIISKNRSLN 231 >SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccharomyces pombe|chr 1|||Manual Length = 549 Score = 25.4 bits (53), Expect = 6.8 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 81 LKSFVEICKTQPQLLHHPQLAFF--KDYLISLGVSLPTATFGAK 206 L+S++ T P LL+ P+L F DY S ++ T G K Sbjct: 183 LQSWLNYVSTNPNLLYDPELQLFVESDYGYSPLINTGNPTSGLK 226 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.0 bits (52), Expect = 9.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 443 YDEAINLYTAAIQLNPQSALLFLNGDRC 526 YD +TA+ + +P S LFLNG RC Sbjct: 635 YDNTRYRFTAS-RSSPGSYHLFLNGSRC 661 >SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 25.0 bits (52), Expect = 9.0 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 130 WCNSCGCVLHISTKDFNWSN 71 WC C C+ H D+ SN Sbjct: 366 WCTYCLCLAHYKLGDYEESN 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,356,688 Number of Sequences: 5004 Number of extensions: 42929 Number of successful extensions: 119 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -