BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10470 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.4 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 9.8 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 9.8 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 109 VLHISTKDFNWSNCSALYGQLIFLC 35 ++ + K + W + S L G FLC Sbjct: 380 LVSLDKKQYTWRHTSVLIGWSAFLC 404 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = -2 Query: 121 SCGCVLHISTKDFNWSNCSALYGQL 47 S G +LHI + C YG + Sbjct: 109 SAGSLLHICMLELGHEVCGRFYGNI 133 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.0 bits (42), Expect = 9.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +3 Query: 126 HHPQLAFFKDYLISLGVSLPTATFGAKDFTAAGDKKSSNE 245 ++PQ+ F DY I V L K D KS N+ Sbjct: 121 YNPQVDFVADYKIEGKVLLLPVRGAGKSNITMYDLKSHND 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,588 Number of Sequences: 438 Number of extensions: 3028 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -