BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10461 (830 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023812-1|AAZ66319.1| 933|Drosophila melanogaster RE19438p pro... 31 2.6 AY089434-1|AAL90172.1| 933|Drosophila melanogaster AT25429p pro... 31 2.6 AE014297-3787|AAF56459.1| 933|Drosophila melanogaster CG10669-P... 31 2.6 X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. 30 3.4 AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-P... 29 5.9 AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-P... 29 5.9 AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-P... 29 5.9 >BT023812-1|AAZ66319.1| 933|Drosophila melanogaster RE19438p protein. Length = 933 Score = 30.7 bits (66), Expect = 2.6 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 647 LRARDRYTCQRPSA-RSFRFLPFLSRHVRRLSPSSSKSGAPFRVPI*SLRHLDPKKL 480 LR + R+ Q P RSF P L +H+R + + G + + L L P KL Sbjct: 810 LRRKRRFRYQCPHCWRSFVVQPSLDKHIRDMHVAKKNPGKKYLCSLCGLESLTPNKL 866 >AY089434-1|AAL90172.1| 933|Drosophila melanogaster AT25429p protein. Length = 933 Score = 30.7 bits (66), Expect = 2.6 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 647 LRARDRYTCQRPSA-RSFRFLPFLSRHVRRLSPSSSKSGAPFRVPI*SLRHLDPKKL 480 LR + R+ Q P RSF P L +H+R + + G + + L L P KL Sbjct: 810 LRRKRRFRYQCPHCWRSFVVQPSLDKHIRDMHVAKKNPGKKYLCSLCGLESLTPNKL 866 >AE014297-3787|AAF56459.1| 933|Drosophila melanogaster CG10669-PA protein. Length = 933 Score = 30.7 bits (66), Expect = 2.6 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 647 LRARDRYTCQRPSA-RSFRFLPFLSRHVRRLSPSSSKSGAPFRVPI*SLRHLDPKKL 480 LR + R+ Q P RSF P L +H+R + + G + + L L P KL Sbjct: 810 LRRKRRFRYQCPHCWRSFVVQPSLDKHIRDMHVAKKNPGKKYLCSLCGLESLTPNKL 866 >X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. Length = 1494 Score = 30.3 bits (65), Expect = 3.4 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -3 Query: 438 DGFSPFDVGVHVL**WTLVPNWNNTQPYLGLFF*FIRDFADFGLLVKK*ADLTK 277 DG P D G+ + + + N + Q +LGL F R DF L K D+ K Sbjct: 923 DGIMPNDKGIEAIKNFPIPNNVHTVQSFLGLCSYFRRFIKDFSRLAKPLHDILK 976 >AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-PB, isoform B protein. Length = 1257 Score = 29.5 bits (63), Expect = 5.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 106 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 219 TG A +L++ H PL GVI K P LP+S A Sbjct: 26 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 63 >AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-PC, isoform C protein. Length = 1294 Score = 29.5 bits (63), Expect = 5.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 106 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 219 TG A +L++ H PL GVI K P LP+S A Sbjct: 63 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 100 >AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-PD, isoform D protein. Length = 1272 Score = 29.5 bits (63), Expect = 5.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 106 TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 219 TG A +L++ H PL GVI K P LP+S A Sbjct: 41 TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 78 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,194,602 Number of Sequences: 53049 Number of extensions: 790443 Number of successful extensions: 1708 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1708 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3942192384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -