BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10459 (796 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 29 5.1 Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical pr... 29 5.1 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 234 LPFAIQAAQLLGRAIGAGLFAITPAGE--RGMCCKAIKLGNARV 109 L F+ + L G++IGA L T AGE G K +K G++RV Sbjct: 761 LDFSSDSQYLRGQSIGAHLLFWTKAGEICDGTSVKDVKWGSSRV 804 >Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical protein T03E6.6 protein. Length = 372 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 609 GRWQV*RSRCA*PPHPPRLMRRYRARQVALFGEMCAEPLFVYFSKYIQI 755 G W V R RC PP L R + +F EM ++ +F Y + + I Sbjct: 201 GLW-VPRKRCNYPPGYTELQYAIRVGRKIIFTEMMSQTIFAYLNGSLNI 248 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,901,140 Number of Sequences: 27780 Number of extensions: 375281 Number of successful extensions: 858 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -