BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10458 (817 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12942| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_32943| Best HMM Match : Far-17a_AIG1 (HMM E-Value=7.1) 28 7.9 >SB_12942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 604 PRVCVLSASYLTFSIA*RLTHICMEWDRCVRCR*GAVP-TAYKIGLTFAL 750 P + +L + F A R+TH +RC+R + G V T YK+ FAL Sbjct: 157 PFLFILFSHCCIFYHARRITHRDRRLNRCLRSKRGRVTNTEYKVARIFAL 206 >SB_32943| Best HMM Match : Far-17a_AIG1 (HMM E-Value=7.1) Length = 180 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 255 GTPQVFAWQLFVLHCVRSGALIKPKRYESHARSVL 151 G+P WQ+F+L+ V GA + R+ H +++ Sbjct: 145 GSPYPSTWQVFLLNAVLIGACVLFARFYPHVGNII 179 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,811,935 Number of Sequences: 59808 Number of extensions: 435674 Number of successful extensions: 872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -